PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G00066.1.p
Common NameEUGRSUZ_G00066, LOC104452455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 333aa    MW: 36489.9 Da    PI: 8.2355
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G00066.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.94.3e-3284138358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                        v+YkeClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC+CHRnFHR+eve
  Eucgr.G00066.1.p  84 VVKYKECLKNHAAAMGGTAMDGCGEFMPS-GEEGTIEALTCSACNCHRNFHRKEVE 138
                       689*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.6E-2985137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-3186137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.57687136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2289139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.79E-19252319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-30252320IPR009057Homeodomain-like
TIGRFAMsTIGR015654.7E-27258314IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MELPSQDTDI PIPINSSFGG GHGGHLIHQP QQHDPSSAIA SHNNHINLPR IPSNGPPPQP  60
PPPPPPLEEP QPQHQHVMPY KKVVVKYKEC LKNHAAAMGG TAMDGCGEFM PSGEEGTIEA  120
LTCSACNCHR NFHRKEVEGG GDDHEHQWYN QTPPHNLMNK SGRKFILGHQ IHPKNVNVLG  180
GHEPPHHHHH GLVYPTAAGT LISSRAPPQL HHQMIIPYSI GAHSHSGPSE SDDQEDGGGS  240
GGGGGAGAIR APHHQAVKKR FRTKFTQEQK EKMFSFAEKV GWKIQKQEES VVQQFCQEIG  300
VKRRVLKVWM HNNKHNLAKK NPSDNNTPSS LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-242593161875ZF-HD homeobox family protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G00066.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065227.10.0PREDICTED: zinc-finger homeodomain protein 4-like
TrEMBLA0A059B8L60.0A0A059B8L6_EUCGR; Uncharacterized protein
STRINGVIT_12s0035g01880.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33392665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-73homeobox protein 31